PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009598201.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family WRKY
Protein Properties Length: 233aa    MW: 26406.8 Da    PI: 9.2003
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009598201.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY101.93.6e-32154212159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDg++WrKYGqK vk+s++prsYYrCt+++C+vkk+++r ++d+++v++tYeg Hnh+
  XP_009598201.1 154 LDDGFKWRKYGQKAVKNSTHPRSYYRCTHHTCNVKKQIQRLSKDTSIVVTTYEGIHNHP 212
                     59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.5E-32141212IPR003657WRKY domain
SuperFamilySSF1182905.1E-28146213IPR003657WRKY domain
PROSITE profilePS5081128.116149214IPR003657WRKY domain
SMARTSM007745.9E-37154213IPR003657WRKY domain
PfamPF031062.7E-25155212IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
MHYSSTSIDA GEAPPPPPPP PLPPPLLLSN DLSPANFFIQ PNTSMLNNHL PLHNNSQVGC  60
DNIDWAGLFS SSTNNGIDAG CYVHRAAPIN NSTEPTTMPN VSITPRNIIM EGEQQQQQQQ  120
QQHGGYCRDK GKFRKRKYVP PRIAFHTRST EDILDDGFKW RKYGQKAVKN STHPRSYYRC  180
THHTCNVKKQ IQRLSKDTSI VVTTYEGIHN HPCEKLMETL SPILKQLQFF ARF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A9e-24142211271WRKY transcription factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754474e-60HG975447.1 Solanum pennellii chromosome ch08, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009598201.11e-177PREDICTED: probable WRKY transcription factor 56
TrEMBLK4CPF93e-80K4CPF9_SOLLC; Uncharacterized protein
STRINGSolyc08g081630.1.18e-80(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA63742433
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64000.12e-56WRKY DNA-binding protein 56